Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Popeye domain-containing protein 2 (POPDC2)

This Recombinant Human Popeye domain-containing protein 2 (POPDC2) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Popeye domain-containing protein 2, Popeye protein 2

UniProt

Q9HBU9

Expression Region

1-364

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANSSRVGQLLLQGSACIRWKQDVEGAVYHLANCLLLLGFMGGSGVYGCFYLFGFLSAG YLCCVLWGWFSACGLDIVLWSFLLAVVCLLQLAHLVYRLREDTLPEEFDLLYKTLCLPLQ VPLQTYKEIVHCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY QFMDSPEWESLQPSEEGVFQVTLTAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYD ISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPTAADAGPESEKGDEEVCEPAVSPPQAT PTSLQQTPPCSTPPATTNFPAPPTRARLSRPDSGILASRIPLQSYSQVISRGQAPLAPTH TPEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Dengue Virus 2 Envelope Antibody [FITC]
NBP3-06004F 0.1 mL

Rabbit Polyclonal Dengue Virus 2 Envelope Antibody [FITC]

Sign In for Pricing
View Details
FIL1L, NT (FILIP1L, COL4A3BPIP, DOC1, GIP90, Filamin A-interacting protein 1-like, 130kD GPBP-interacting protein, 90kD GPBP-interacting protein, Protein down-regulated in ovarian cancer 1) (MaxLight 750) discontinued
035660-ML750 100 µL

FIL1L, NT (FILIP1L, COL4A3BPIP, DOC1, GIP90, Filamin A-interacting protein 1-like, 130kD GPBP-interacting protein, 90kD GPBP-interacting protein, Protein down-regulated in ovarian cancer 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit Cytokeratin High Moecular weigh ELISA kit
GTR10390295 96 Well

Rabbit Cytokeratin High Moecular weigh ELISA kit

Sign In for Pricing
View Details
Human Vitamin B6 ELISA kit
GTR10385620 96 Well

Human Vitamin B6 ELISA kit

Sign In for Pricing
View Details
Xylan
12207874-5g 5 g

Xylan

Sign In for Pricing
View Details
TRIM60P16 AAV Vector (Human) (CMV)
47816101 1 µg

TRIM60P16 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details