Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Popeye domain-containing protein 2 (POPDC2)

This Recombinant Human Popeye domain-containing protein 2 (POPDC2) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Popeye domain-containing protein 2, Popeye protein 2

UniProt

Q9HBU9

Expression Region

1-364

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANSSRVGQLLLQGSACIRWKQDVEGAVYHLANCLLLLGFMGGSGVYGCFYLFGFLSAG YLCCVLWGWFSACGLDIVLWSFLLAVVCLLQLAHLVYRLREDTLPEEFDLLYKTLCLPLQ VPLQTYKEIVHCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY QFMDSPEWESLQPSEEGVFQVTLTAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYD ISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPTAADAGPESEKGDEEVCEPAVSPPQAT PTSLQQTPPCSTPPATTNFPAPPTRARLSRPDSGILASRIPLQSYSQVISRGQAPLAPTH TPEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dipeptidyl peptidase 4 (DPP4) ELISA Kit
AE46701MO-01 48 Tests

Mouse Dipeptidyl peptidase 4 (DPP4) ELISA Kit

Sign In for Pricing
View Details
Mouse Dipeptidyl peptidase 4 (DPP4) ELISA Kit
AE46701MO-02 96 Tests

Mouse Dipeptidyl peptidase 4 (DPP4) ELISA Kit

Sign In for Pricing
View Details
Fam131b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
19762116 3x 1.0 µg

Fam131b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Hsa-miR-4309 miRNA Antagomir
orb1915290-01 10 nmol

Hsa-miR-4309 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-4309 miRNA Antagomir
orb1915290-02 20 nmol

Hsa-miR-4309 miRNA Antagomir

Sign In for Pricing
View Details
Anti-C-Kit Antibody (7A806)
TMAB-00436-01 25 µL

Anti-C-Kit Antibody (7A806)

Sign In for Pricing
View Details