Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma capricolum subsp. capricolum Uncharacterized protein MCAP_0005 (MCAP_0005)

This Recombinant Mycoplasma capricolum subsp. capricolum Uncharacterized protein MCAP_0005 (MCAP_0005) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Uncharacterized protein MCAP_0005, ORF L5

UniProt

P43040

Expression Region

1-364

Origin

Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISDFNNQEITLEDLEQNNVKLKEGKAKVQFLMRFSLVFSNIFTHIFLFLLIIVSGLFFG LRYTYYNYKIDLITNVYKIKPSIPKLKEIYKEVLEVVDEVKRETDKNSEDSLINKIDEIR GIVKEVTNIAKEFDEKSKEVKPKVEKVIQEGKQVTSNLDKITKEIQALQVNGNGLASRVR RSLTGDINTITNLANNIDFDFNSVKESIEKITGLAQQISKEGKSITKNVEEIKNEVEYFT GKSKEPLKDIDKIKQIYDKKIPIFEKNNKKLQEIWNKLMGIYNEFTVKETKKDYYNYVIY ILLFLIIDSLILLVITYMSMISKTIKKLLLFYIFGLLSFNPIVWASIIISLFSRPIKNRK NKFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL
BNC741037-100 1x 100 µL

CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL
BNC040669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-100 1x 100 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-500 1x 500 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details