Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma capricolum subsp. capricolum Uncharacterized protein MCAP_0005 (MCAP_0005)

This Recombinant Mycoplasma capricolum subsp. capricolum Uncharacterized protein MCAP_0005 (MCAP_0005) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Uncharacterized protein MCAP_0005, ORF L5

UniProt

P43040

Expression Region

1-364

Origin

Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISDFNNQEITLEDLEQNNVKLKEGKAKVQFLMRFSLVFSNIFTHIFLFLLIIVSGLFFG LRYTYYNYKIDLITNVYKIKPSIPKLKEIYKEVLEVVDEVKRETDKNSEDSLINKIDEIR GIVKEVTNIAKEFDEKSKEVKPKVEKVIQEGKQVTSNLDKITKEIQALQVNGNGLASRVR RSLTGDINTITNLANNIDFDFNSVKESIEKITGLAQQISKEGKSITKNVEEIKNEVEYFT GKSKEPLKDIDKIKQIYDKKIPIFEKNNKKLQEIWNKLMGIYNEFTVKETKKDYYNYVIY ILLFLIIDSLILLVITYMSMISKTIKKLLLFYIFGLLSFNPIVWASIIISLFSRPIKNRK NKFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-17C Antibody (177114) [Janelia Fluor 646]
FAB1234J 0.5 mL

Mouse Monoclonal IL-17C Antibody (177114) [Janelia Fluor 646]

Sign In for Pricing
View Details
NF2 (NM_000268) Human Mutant ORF Clone
RC401947 10 µg

NF2 (NM_000268) Human Mutant ORF Clone

Sign In for Pricing
View Details
Abscisic Acid (Dormin)
B4883-100 100 mg

Abscisic Acid (Dormin)

Sign In for Pricing
View Details
Anti-Hu CD54 FITC
1F-429-T025 25 Tests

Anti-Hu CD54 FITC

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase TRIM13 (TRIM13) Human ELISA Kit
D0822 96 Tests

E3 ubiquitin-protein ligase TRIM13 (TRIM13) Human ELISA Kit

Sign In for Pricing
View Details
KRT19P2 Protein Vector (Human) (pPM-C-His)
PV089705 500 ng

KRT19P2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details