Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthomonas phage phiLf Attachment protein G3P (III)

This Recombinant Xanthomonas phage phiLf Attachment protein G3P (III) spans the amino acid sequence from region 1-367.

Product Specifications

Product Name Alternative

Attachment protein G3P, Gene 3 protein, G3P, Minor coat protein

UniProt

Q37972

Expression Region

1-367

Origin

Xanthomonas phage phiLf (Bacteriophage phi-Lf)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPSLFLGWGDDYFVVLWIHGRAVRLGRRQGVGRVIRVSLAMLILLALTFSPIVHATCVQ TEPSTSANNGSWACSDQGEAFAKASSMGVPADLSVCRMKSIRAVSSGPGVFSQRMTYPGD TCGIGYDLDIGTGNATYPDTATCAKRPSQSGWTNPTAPTPSDVCNDGCYYTYAVDAGGPK GYTYVPSGATCTTDDAAPPIDDGGDGDDDGGGDGGGDGGGDGGGDGGGDGGGDGGGDGGG DGGGDGGGDGDGGGDGDGDGDGDGDGEEGGEGAPMSELYKKSGKTVESVLSKFNTQVRGT PMVAGIGDFMKVPSGGSCPVFSLGASKWWDAMTINFHCGGDFLAFLRAAGWVILAIAAYA AIRIAVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-500 1x 500 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-100 1x 100 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF647 conjugate, 0.1mg/mL
BNC470324-500 1x 500 µL

CD53 (161-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details