Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

This Recombinant Debaryomyces hansenii Mitochondrial import inner membrane translocase subunit TIM50 (TIM50) spans the amino acid sequence from region 105-471.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM50

UniProt

Q6BVY9

Expression Region

105-471

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RERYANMFYLATLVGGIAGVGYMCRDWDSEDEQTKLEGKDIDNGFAPNLMYGRLNKRLGS LFTFFSEPVFENLLPPPAPEAYRRPLTLVVTLDDLLIHSDWDTKHGWRTGKRPGLDYFLG YLSQYYEIVIFGSNYQMYSENTVGKLDPFHAYVSYALFREACRYKDGKLVKDLSLLNRDL GKTVLIDVEEDSWSMQPDNAIPMKPWDGSYDDTLVKLIPFLEYLATQPVKDVRPILNSFK DKSNIVQEFAEREAKLREQWKKDNKHLFDSANRPNAGNFLASLMGVPTSSVNKEPKMPLD IIREHGQLQYEHFQKYLKENAPKFLEEEQKLKDEFGKVSLNKLITEGAPSADDIAKVQAE RAAAQQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TASK-1 Antibody
OAAF05983-100UG 100 µg

TASK-1 Antibody

Sign In for Pricing
View Details
Goose Prothrombin ELISA Kit
MBS010321 Inquire

Goose Prothrombin ELISA Kit

Sign In for Pricing
View Details
SUCLG1 (NM_003849) Human Over-expression Lysate
LC418395 20 µg

SUCLG1 (NM_003849) Human Over-expression Lysate

Sign In for Pricing
View Details
MYOT, ID (MYOT, TTID, Myotilin, 57kD cytoskeletal protein, Myofibrillar titin-like Ig domains protein, Titin immunoglobulin domain protein) (MaxLight 490) discontinued
038763-ML490 100 µL

MYOT, ID (MYOT, TTID, Myotilin, 57kD cytoskeletal protein, Myofibrillar titin-like Ig domains protein, Titin immunoglobulin domain protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
RBM42 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
38634062 1.0 µg DNA

RBM42 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Shewanella oneidensis UPF0260 protein SO_2573 (SO_2573)
MBS1438749-01 0.02 mg (E-Coli)

Recombinant Shewanella oneidensis UPF0260 protein SO_2573 (SO_2573)

Sign In for Pricing
View Details