Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Mitochondrial import inner membrane translocase subunit TIM50-B (ttm2)

This Recombinant Drosophila melanogaster Mitochondrial import inner membrane translocase subunit TIM50-B (ttm2) spans the amino acid sequence from region 43-409.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM50-B, Tiny tim 2

UniProt

Q9W0S3

Expression Region

43-409

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDVGKPGMELGRCSCFGLRVNLSNASVVYVGHRRYSTYEKTSTQILTKLFPQTSEESNDE ESRERRKLEEEEEQKELERAFRRMKLGFGLFGIGSMLFSFWAIYFYGRPSLDEHGNEVID EFSCLPQMQQLMWRTWKSVNRFQRFFKEPSRKKLLPDPLQPPYVQPPYTLVLEIKDVLVH PDWTYETGWRFKKRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVR DSTHFDGGHHVKNLDNLNRDLKRVVVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELT SFLSVLGTSEIDDVREVLQYYNQFSDSLSQFRENQRKLGELMHAEEVEKTSKSRPVVKNW TRGFINH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-100 1x 100 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-500 1x 500 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (MSN/493), CF568 conjugate, 0.1mg/mL
BNC680493-100 1x 100 µL

Moesin (MSN/493), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (C6/372 + 3F7B5), CF594 conjugate, 0.1mg/mL
BNC941228-500 1x 500 µL

CD6 (C6/372 + 3F7B5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (Mucin 2) (MLP/2970R), CF568 conjugate, 0.1mg/mL
BNC682970-100 1x 100 µL

MUC2 (Mucin 2) (MLP/2970R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details