Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

This Recombinant Candida albicans Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1) spans the amino acid sequence from region 1-368.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane i-AAA protease complex subunit MGR1

UniProt

Q5AHC2

Expression Region

1-368

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVYIPPPNDKDDGDKKKQDTNSNTNQPTPPSSSSPSGSTTIYIPNPASSIPRNPKVGLI WGPLTPASDNLPALYSMIGLQFVIGCGFFKYARTLSRLRPIGGFQQQPHAHMAPKLVRTG PIWKIALSVITGSALSFGSGLELCRVTLPYDPWYDEAQHYRRMAVKNGDKPSSWFGAYRY YKPMDFKTWIDKVGDWIENVEKEIKIDDPANFANLSLELGKNSNVINVQRQPQTSGGILN KLNNKGKYLEIYTKLNENNTKRWEKLLHEDLNEVTELNKAPRLDLILEGKSDLINPEFTK SAIILGNHTMDDDDQFEMVWLNFEPWDELKLDTEYDIRLVPSYAGATEEIENEDQESPLT DNVVAKQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF647 conjugate, 0.1mg/mL
BNC470693-500 1x 500 µL

CD56 / NCAM (123C3.D5 + 123A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF594 conjugate, 0.1mg/mL
BNC941926-500 1x 500 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3/863 + 1G12), CF594 conjugate, 0.1mg/mL
BNC940864-500 1x 500 µL

Glypican-3 (GPC3/863 + 1G12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1b (RIV12), CF405S conjugate, 0.1mg/mL
BNC040317-500 1x 500 µL

CD1b (RIV12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details