Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

This Recombinant Candida albicans Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1) spans the amino acid sequence from region 1-368.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane i-AAA protease complex subunit MGR1

UniProt

Q5AHC2

Expression Region

1-368

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVYIPPPNDKDDGDKKKQDTNSNTNQPTPPSSSSPSGSTTIYIPNPASSIPRNPKVGLI WGPLTPASDNLPALYSMIGLQFVIGCGFFKYARTLSRLRPIGGFQQQPHAHMAPKLVRTG PIWKIALSVITGSALSFGSGLELCRVTLPYDPWYDEAQHYRRMAVKNGDKPSSWFGAYRY YKPMDFKTWIDKVGDWIENVEKEIKIDDPANFANLSLELGKNSNVINVQRQPQTSGGILN KLNNKGKYLEIYTKLNENNTKRWEKLLHEDLNEVTELNKAPRLDLILEGKSDLINPEFTK SAIILGNHTMDDDDQFEMVWLNFEPWDELKLDTEYDIRLVPSYAGATEEIENEDQESPLT DNVVAKQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOT1 Antibody
OAAN01555-100UL 100 µL

GOT1 Antibody

Sign In for Pricing
View Details
Mouse Osteoprotegerin Ligand (OPGL) ELISA Kit
QY-E21121 96 Tests

Mouse Osteoprotegerin Ligand (OPGL) ELISA Kit

Sign In for Pricing
View Details
Anti-ERBB1/EGFR/HER1 Antibody (Depatuxizumab-MMAF)
F1979-1 1 mg

Anti-ERBB1/EGFR/HER1 Antibody (Depatuxizumab-MMAF)

Sign In for Pricing
View Details
Cucurbitacin I
525350 1.0mg

Cucurbitacin I

Sign In for Pricing
View Details
PTTG1IP antibody
FNab06953 100 µg

PTTG1IP antibody

Sign In for Pricing
View Details
RAB33B (Ras-related Protein Rab-33B, SMC2) (MaxLight 750) discontinued
132194-ML750 100 µL

RAB33B (Ras-related Protein Rab-33B, SMC2) (MaxLight 750) discontinued

Sign In for Pricing
View Details