Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD)

This Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD) spans the amino acid sequence from region 26-394.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

P57083

Expression Region

26-394

Origin

Human herpesvirus 1 (strain Patton) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYA VLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSY NKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFI LEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAG WHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQ DAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMHRRTRKAPKRIRLPHIREDDQ PSSHQPLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SIRT1 Antibody Pair Set
E-KAB-0701 50 µL & 100 µg

Human SIRT1 Antibody Pair Set

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), CF640R conjugate, 0.1mg/mL
BNC403497-500 1x 500 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 647 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09742M-01 20 Tests

Elab Fluor® 647 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
Elab Fluor® 647 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09742M-02 100 Tests

Elab Fluor® 647 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
Elab Fluor® 647 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09742M-03 2x 100 Tests

Elab Fluor® 647 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
TEKT2 (NM_014466) Human Recombinant Protein
TP307425 20 µg

TEKT2 (NM_014466) Human Recombinant Protein

Sign In for Pricing
View Details