Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD)

This Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD) spans the amino acid sequence from region 26-394.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

P57083

Expression Region

26-394

Origin

Human herpesvirus 1 (strain Patton) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYA VLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSY NKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFI LEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAG WHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQ DAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMHRRTRKAPKRIRLPHIREDDQ PSSHQPLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gastrin-71 Protein, Fc tag
GAN-H5253-200ug 200 µg

Human Gastrin-71 Protein, Fc tag

Sign In for Pricing
View Details
Tnrc18 Mouse Gene Knockout Kit (CRISPR)
KN518031 1 Kit

Tnrc18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MRPS33 Human Gene Knockout Kit (CRISPR)
KN401865 1 Kit

MRPS33 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AIG1 Antibody
8C14468-AAT 50 µg

AIG1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS508106 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Recombinant Mouse Serpin F1/PEDF Protein
PKSM041232-01 10 µg

Recombinant Mouse Serpin F1/PEDF Protein

Sign In for Pricing
View Details