Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD)

This Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD) spans the amino acid sequence from region 26-394.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

P57083

Expression Region

26-394

Origin

Human herpesvirus 1 (strain Patton) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYA VLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSY NKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFI LEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAG WHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQ DAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMHRRTRKAPKRIRLPHIREDDQ PSSHQPLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF594 conjugate, 0.1mg/mL
BNC942729-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IRE1 (ERN1) (NM_001433) Human Over-expression Lysate
LY419940 100 µg

IRE1 (ERN1) (NM_001433) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CCDC188 activation kit by CRISPRa
GA118005 1 Kit

Human CCDC188 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Activator of basal transcription 1 (ABT1) activation kit by CRISPRa
GA109266 1 Kit

Human Activator of basal transcription 1 (ABT1) activation kit by CRISPRa

Sign In for Pricing
View Details
DraI, 600U
RE1254 600 U

DraI, 600U

Sign In for Pricing
View Details
TGFBR1 Antibody
KC-44415-01 50 μL

TGFBR1 Antibody

Sign In for Pricing
View Details