Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD)

This Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD) spans the amino acid sequence from region 26-394.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

A1Z0Q5

Expression Region

26-394

Origin

Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYA VLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSY NKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFI LEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAG WHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQ DAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMHRRTRKAPKRIRLPHIREDDQ PSSHQPLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Plasminogen Activator (tPA)
T5600-12 200 µg

Tissue Plasminogen Activator (tPA)

Sign In for Pricing
View Details
MULTIMEDIA-PACKAGE. The Plant Cell (Cytology), Basic Set of 6 slides and teaching material, Teacher Set
SMD-28 34 x 25 x 5 cm

MULTIMEDIA-PACKAGE. The Plant Cell (Cytology), Basic Set of 6 slides and teaching material, Teacher Set

Sign In for Pricing
View Details
RCVRN Rabbit Polyclonal Antibody
orb574964 100 µL

RCVRN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human GPR52 qPCR Primer Pair
QH07049S 200 Tests

Human GPR52 qPCR Primer Pair

Sign In for Pricing
View Details
4E-BP2 (h) -PR
sc-77246-PR 10 µM - 20 µL

4E-BP2 (h) -PR

Sign In for Pricing
View Details
Xanomeline Impurity 5
RM-X011305-01 10 mg

Xanomeline Impurity 5

Sign In for Pricing
View Details