Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD)

This Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD) spans the amino acid sequence from region 26-394.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

A1Z0Q5

Expression Region

26-394

Origin

Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYA VLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSY NKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFI LEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAG WHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQ DAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMHRRTRKAPKRIRLPHIREDDQ PSSHQPLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPTBN1 (Spectrin Beta Chain, Non-Erythrocytic 1, Spectrin Beta, Non-Erythrocytic 1)
492777 100 µL

SPTBN1 (Spectrin Beta Chain, Non-Erythrocytic 1, Spectrin Beta, Non-Erythrocytic 1)

Sign In for Pricing
View Details
Human Troponin I Type 2, Fast Skeletal (TNNI2) ELISA Kit
DLR-TNNI2-Hu-01 48 Tests

Human Troponin I Type 2, Fast Skeletal (TNNI2) ELISA Kit

Sign In for Pricing
View Details
Human Troponin I Type 2, Fast Skeletal (TNNI2) ELISA Kit
DLR-TNNI2-Hu-02 96 Tests

Human Troponin I Type 2, Fast Skeletal (TNNI2) ELISA Kit

Sign In for Pricing
View Details
HSPA2 shRNA (m) Lentiviral Particles
sc-146099-V 200 µL

HSPA2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
FITC-linked Antibody to Heme Oxygenase 1, Decycling (HO1)
MBS2013542-01 0.1 mL

FITC-linked Antibody to Heme Oxygenase 1, Decycling (HO1)

Sign In for Pricing
View Details
FITC-linked Antibody to Heme Oxygenase 1, Decycling (HO1)
MBS2013542-02 0.2 mL

FITC-linked Antibody to Heme Oxygenase 1, Decycling (HO1)

Sign In for Pricing
View Details