Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD)

This Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD) spans the amino acid sequence from region 26-394.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

Q69091

Expression Region

26-394

Origin

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KYALVDASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYA VLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSY NKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFI LEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAG WHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQ DAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMRRHTQKAPKRIRLPHIREDDQ PSSHQPLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ctla4 Mouse Gene Knockout Kit (CRISPR)
KN303962LP 1 Kit

Ctla4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TBL1 (TBL1X) Rabbit Polyclonal Antibody
TA369390 100 µL

TBL1 (TBL1X) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tilavonemab Biosimilar - Research Grade
ICH5125-20mg 20 mg

Tilavonemab Biosimilar - Research Grade

Sign In for Pricing
View Details
Tris-NTA per-Tert-butyl Ester
TRC-T875550-25MG 25 mg

Tris-NTA per-Tert-butyl Ester

Sign In for Pricing
View Details
RCOR3 Human Gene Knockout Kit (CRISPR)
KN417218 1 Kit

RCOR3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human THAP6 activation kit by CRISPRa
GA115844 1 Kit

Human THAP6 activation kit by CRISPRa

Sign In for Pricing
View Details