Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD)

This Recombinant Human herpesvirus 1 Envelope glycoprotein D (gD) spans the amino acid sequence from region 26-394.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

Q69091

Expression Region

26-394

Origin

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KYALVDASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYA VLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSY NKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFI LEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAG WHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQ DAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMRRHTQKAPKRIRLPHIREDDQ PSSHQPLFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPPA5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F6]
TA810842BM 100 µL

DPPA5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F6]

Sign In for Pricing
View Details
Ngb (NM_022414) Mouse Tagged ORF Clone
MG201076 10 µg

Ngb (NM_022414) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NDUFS6 Antibody
8C16848-AAT 50 µg

NDUFS6 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS700338 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
ATP5F1E (NM_001001977) Human Over-expression Lysate
LY424306 100 µg

ATP5F1E (NM_001001977) Human Over-expression Lysate

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details