Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Peptidoglycan-recognition protein LF (PGRP-LF)

This Recombinant Drosophila melanogaster Peptidoglycan-recognition protein LF (PGRP-LF) spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Peptidoglycan-recognition protein LF, PGRP-like protein

UniProt

Q8SXQ7

Expression Region

1-369

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKTVVVTHPGKPINNEKRFRFELLYFCVILLMVVGLAAGYFMWMMSFSTHSPNKGLHIL DRSEWLGEPPSGKYPHLKLPVSNIIIHHTATEGCEQEDVCIYRMKTIQAFHMKSFGWVDI GYNFLVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVNMEPPARQIEAAKRLMDE GVRLHRLQPDYHIYAHRQLSPTESPGQKLFELMQNWPRFTQDPTSLRLLSNETVKIVTRP YWLAQPPIVPLTPLKLPIESVRFVATNTPSCFTQAECTFRVRLLQNWHIESNGYKDINYN FVAAGDENIYEARGWDHSCEPPKDADELVVAFIGPSSSNKKIALELIKQGIKLGHISKNY SLIDDLEKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-500 1x 500 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-100 1x 100 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF594 conjugate, 0.1mg/mL
BNC942746-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF488A conjugate, 0.1mg/mL
BNC881986-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (AE-1 / AE-3), CF640R conjugate, 0.1mg/mL
BNC400371-100 1x 100 µL

Cytokeratin, pan (AE-1 / AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details