Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 7 (Hsd3b7)

This Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 7 (Hsd3b7) spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase type 7, 3 beta-hydroxysteroid dehydrogenase type VII, 3-beta-HSD VII, 3-beta-hydroxy-Delta (5) -C27 steroid oxidoreductase, C (27) 3-beta

UniProt

Q9EQC1

Expression Region

1-369

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADSAQVPTLVYLVTGGCGFLGEHIVRMLLEREPRLRELRVFDLHLSSWLEELKAGPVQV TAIQGDVTQAHEVAAAMSGSHVVIHTAGLVDVFGKASPKTIHKVNVQGTQNVIDACVQTG TQYLVYTSSMEVVGPNIKGHPFYRGNEDTPYEAVHSHPYPCSKALAEQLVLEANGRKVNG GLPLVTCALRPTGIYGEGHQVMRDFYYQGLRFGGRLFRAVPASVEHGRVYVGNVAWMHIL VARELEQRAALMGGQVYFCYDKSPYKSYEDFNMEFLSPCGLRLIGAHPLLPYWLLVLLAT LNALLQWLLRPLVLYTPLLNPYTLAMANTTFTVSTNKAQRHFGYKPLFSWEESRTRTIQW VQAMEGSAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CASP8 Protein (Trx Tag)
PDEH100561-01 20 µg

Recombinant Human CASP8 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CASP8 Protein (Trx Tag)
PDEH100561-02 100 µg

Recombinant Human CASP8 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CASP8 Protein (Trx Tag)
PDEH100561-03 500 µg

Recombinant Human CASP8 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CASP8 Protein (Trx Tag)
PDEH100561-04 1 mg

Recombinant Human CASP8 Protein (Trx Tag)

Sign In for Pricing
View Details
RNF126 Polyclonal Antibody
E-AB-12633-01 20 µL

RNF126 Polyclonal Antibody

Sign In for Pricing
View Details
RNF126 Polyclonal Antibody
E-AB-12633-02 60 µL

RNF126 Polyclonal Antibody

Sign In for Pricing
View Details