Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 7 (Hsd3b7)

This Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 7 (Hsd3b7) spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase type 7, 3 beta-hydroxysteroid dehydrogenase type VII, 3-beta-HSD VII, 3-beta-hydroxy-Delta (5) -C27 steroid oxidoreductase, C (27) 3-beta

UniProt

Q9EQC1

Expression Region

1-369

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADSAQVPTLVYLVTGGCGFLGEHIVRMLLEREPRLRELRVFDLHLSSWLEELKAGPVQV TAIQGDVTQAHEVAAAMSGSHVVIHTAGLVDVFGKASPKTIHKVNVQGTQNVIDACVQTG TQYLVYTSSMEVVGPNIKGHPFYRGNEDTPYEAVHSHPYPCSKALAEQLVLEANGRKVNG GLPLVTCALRPTGIYGEGHQVMRDFYYQGLRFGGRLFRAVPASVEHGRVYVGNVAWMHIL VARELEQRAALMGGQVYFCYDKSPYKSYEDFNMEFLSPCGLRLIGAHPLLPYWLLVLLAT LNALLQWLLRPLVLYTPLLNPYTLAMANTTFTVSTNKAQRHFGYKPLFSWEESRTRTIQW VQAMEGSAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-L-beta- homoserine (OBzl)
CSB-DT3828 0.25 g

Boc-L-beta- homoserine (OBzl)

Sign In for Pricing
View Details
ITGAM (Integrin Alpha-M, CD11 Antigen-Like Family Member B, CR-3 Alpha Chain, Cell surface Glycoprotein MAC-1 Subunit Alpha, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor, CD11b, CD11B, CR3A)
397461 100 µg

ITGAM (Integrin Alpha-M, CD11 Antigen-Like Family Member B, CR-3 Alpha Chain, Cell surface Glycoprotein MAC-1 Subunit Alpha, Leukocyte Adhesion Receptor MO1, Neutrophil Adherence Receptor, CD11b, CD11B, CR3A)

Sign In for Pricing
View Details
KLF4 (N-Term) Rabbit pAb
MBS8558777-01 0.1 mL

KLF4 (N-Term) Rabbit pAb

Sign In for Pricing
View Details
KLF4 (N-Term) Rabbit pAb
MBS8558777-02 0.1 mL (AF405L)

KLF4 (N-Term) Rabbit pAb

Sign In for Pricing
View Details
KLF4 (N-Term) Rabbit pAb
MBS8558777-03 0.1 mL (AF405S)

KLF4 (N-Term) Rabbit pAb

Sign In for Pricing
View Details
KLF4 (N-Term) Rabbit pAb
MBS8558777-04 0.1 mL (AF610)

KLF4 (N-Term) Rabbit pAb

Sign In for Pricing
View Details