Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gallid herpesvirus 2 Envelope glycoprotein D (MDV094)

This Recombinant Gallid herpesvirus 2 Envelope glycoprotein D (MDV094) spans the amino acid sequence from region 35-403.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

Q9E6L6

Expression Region

35-403

Origin

Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLKKDNSPIIPTLHPKGNENLRATLNEYKIPSPLFDTLDNSYETKHVIYTDNCSFAVLN PFGDPKYTLLSLLLMGRRKYDALVAWFVLGRACGRPIYLREYANCSTNEPFGTCKLKSLG WWDRRYAMTSYIDRDELKLIIAAPSRELSGLYTRLIIINGEPISSDILLTVKETCSFSRR GIKDNKLCKPFSFFVNGTTRLLDMVGTGTPRAHEENVKQWLERIGGKHLPIVVETSMQQV SNLPRSFRDSYFKSPDDDKYDDVKMTSATTNNITTSVDGYTGLTNRPEDFEKAPYITKRP IISVEEASSQSPKISTEKKSRTQIIISLVVLCVMFCFIVIGSGIWILRKHRKTVMYDRRR PSRRAYSRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Langerin / CD207 (Marker of Langerhans Cells) (LGRN/1821), CF405S conjugate, 0.1mg/mL
BNC041821-100 1x 100 µL

Langerin / CD207 (Marker of Langerhans Cells) (LGRN/1821), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SALL1P1 Human qPCR Primer Pair (XM_066513)
HP220920 200 Reactions

SALL1P1 Human qPCR Primer Pair (XM_066513)

Sign In for Pricing
View Details
TTC23 (NM_001288616) Human Tagged ORF Clone
RG238287 10 µg

TTC23 (NM_001288616) Human Tagged ORF Clone

Sign In for Pricing
View Details
7-Chloro-L-Tryptophan
TRC-C386158-5MG 5 mg

7-Chloro-L-Tryptophan

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS634149 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
ReadiLink™ Rapid mFluor™ Violet 610 Antibody Labeling Kit *Microscale Optimized for Labeling 50 µg Antibody Per Reaction*
1116-AAT 2 Labelings

ReadiLink™ Rapid mFluor™ Violet 610 Antibody Labeling Kit *Microscale Optimized for Labeling 50 µg Antibody Per Reaction*

Sign In for Pricing
View Details