Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

This Recombinant Candida glabrata Mitochondrial intermembrane space import and assembly protein 40 (MIA40) spans the amino acid sequence from region 35-404.

Product Specifications

Product Name Alternative

Mitochondrial intermembrane space import and assembly protein 40, Mitochondrial import inner membrane translocase TIM40

UniProt

Q6FW26

Expression Region

35-404

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSKYAQESENAKRHKMGLLIAGVAVAGAIVFVTPPQWKKYFRAAKKVEEVAESKEDPVSE AAEEVSESVQESTEEPQQSQEKETADVGNEQAQDESASSGDSEAKKAHDEFADQNEASEK ESAPMGESADADQTAKDETVAEKTGNSKSESSESDQSEQDILSSDLEETMETVSEADKEL HQISDNTVLSSEEDKTPKAEELKSTSPSGNDEEPKKEDDSSKTIHSLNSEKDMEAVEEEV KQESAYNPDTGEINWDCPCLGGMAHGPCGEEFKAAFSCFVYSEAEPKGIDCVEKFQHMQD CFRRYPEHYAEQLADPADDENVDHEKNLSEGKDTGVDSTPPKDEAYLKTEKEKKIEENAS PDEDTASKKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYS1 Protein Vector (Mouse) (pPM-C-HA)
PV169888 500 ng

CYS1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Cynomolgus Fc gamma RI / CD64 Protein, His Tag (MALS & SPR verified)
FCA-C52H6-50ug 50 µg

Cynomolgus Fc gamma RI / CD64 Protein, His Tag (MALS & SPR verified)

Sign In for Pricing
View Details
LAGE3 Rabbit Polyclonal Antibody (Biotin)
orb2085994 100 µL

LAGE3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
IL9R Antibody
A23370-50UG 50 µg

IL9R Antibody

Sign In for Pricing
View Details
CTTNBP2NL Peptide - N-terminal region (AAP68240)
AAP68240-100UG 100 µg

CTTNBP2NL Peptide - N-terminal region (AAP68240)

Sign In for Pricing
View Details
BRP44 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
13487154 3x 1.0 µg DNA

BRP44 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details