Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein mxiG (mxiG)

This Recombinant Protein mxiG (mxiG) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Protein mxiG

UniProt

P0A221

Expression Region

1-371

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEAKNSNLAPFRLLVKLTNGVGDEFPLYYGNNLIVLGRTIETLEFGNDNFPENIIPVTD SKSDGIIYLTISKDNICQFSDEKGEQIDINSQFNSFEYDGISFHLKNMREDKSRGHILNG MYKNHSVFFFFAVIVVLIIIFSLSLKKDEVKEIAEIIDDKRYGIVNTGQCNYILAETQND AVWASVALNKTGFTKCRYILVSNKEINRIQQYINQRFPFINLYVLNLVSDKAELLVFLSK ERNSSKDTELDKLKNALIVEFPYIKNIKFNYLSDHNARGDAKGIFTKVNVQYKEICENNK VTYSVREELTDEKLELINRLISEHKNIYGDQYIEFSVLLIDDDFKGKSYLNSKDSYVMLN DKHWFFLDKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human/Mouse/Rat Cardiac Myoglobin MAb (Clone 2269B)
MAB97203-SP 25 µg

Human/Mouse/Rat Cardiac Myoglobin MAb (Clone 2269B)

Sign In for Pricing
View Details
BCL3 (B Cell Lymphoma 3 Protein, BCL-3, Proto-oncogene BCL3, BCL4, D19S37) (HRP)
123894-HRP 100 µL

BCL3 (B Cell Lymphoma 3 Protein, BCL-3, Proto-oncogene BCL3, BCL4, D19S37) (HRP)

Sign In for Pricing
View Details
Mouse Monoclonal OGG1 Antibody (2B4) [Alexa Fluor 700]
NBP2-52724AF700 0.1 mL

Mouse Monoclonal OGG1 Antibody (2B4) [Alexa Fluor 700]

Sign In for Pricing
View Details
TGM4 Conjugated Antibody
C40348 100 µL

TGM4 Conjugated Antibody

Sign In for Pricing
View Details
ZKSCAN1 (Zinc Finger Protein with KRAB and SCAN Domains 1, Zinc Finger Protein 36, ZNF36, Zinc Finger Protein 139, ZNF139, Zinc Finger Protein KOX18, KOX18, 9130423L19Rik, PHZ-37, ZSCAN33) (HRP)
135574-HRP 100 µL

ZKSCAN1 (Zinc Finger Protein with KRAB and SCAN Domains 1, Zinc Finger Protein 36, ZNF36, Zinc Finger Protein 139, ZNF139, Zinc Finger Protein KOX18, KOX18, 9130423L19Rik, PHZ-37, ZSCAN33) (HRP)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus subsp. pastoris 15,16-dihydrobiliverdin:ferredoxin oxidoreductase (pebA)
MBS1444913-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus subsp. pastoris 15,16-dihydrobiliverdin:ferredoxin oxidoreductase (pebA)

Sign In for Pricing
View Details