Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein mxiG (mxiG)

This Recombinant Protein mxiG (mxiG) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Protein mxiG

UniProt

P0A221

Expression Region

1-371

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEAKNSNLAPFRLLVKLTNGVGDEFPLYYGNNLIVLGRTIETLEFGNDNFPENIIPVTD SKSDGIIYLTISKDNICQFSDEKGEQIDINSQFNSFEYDGISFHLKNMREDKSRGHILNG MYKNHSVFFFFAVIVVLIIIFSLSLKKDEVKEIAEIIDDKRYGIVNTGQCNYILAETQND AVWASVALNKTGFTKCRYILVSNKEINRIQQYINQRFPFINLYVLNLVSDKAELLVFLSK ERNSSKDTELDKLKNALIVEFPYIKNIKFNYLSDHNARGDAKGIFTKVNVQYKEICENNK VTYSVREELTDEKLELINRLISEHKNIYGDQYIEFSVLLIDDDFKGKSYLNSKDSYVMLN DKHWFFLDKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Transitional endoplasmic reticulum ATPase
E15581r 96 Tests

ELISA Kit For Transitional endoplasmic reticulum ATPase

Sign In for Pricing
View Details
SMA antibody
10R-10547 100 ug

SMA antibody

Sign In for Pricing
View Details
pRK5-HA-Ubiquitin-K29R Plasmid
PVT48872 2 µg

pRK5-HA-Ubiquitin-K29R Plasmid

Sign In for Pricing
View Details
Recombinant Ralstonia solanacearum ATP synthase subunit delta (atpH)
MBS1341842-01 0.02 mg (E-Coli)

Recombinant Ralstonia solanacearum ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Ralstonia solanacearum ATP synthase subunit delta (atpH)
MBS1341842-02 0.1 mg (E-Coli)

Recombinant Ralstonia solanacearum ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Ralstonia solanacearum ATP synthase subunit delta (atpH)
MBS1341842-03 0.02 mg (Yeast)

Recombinant Ralstonia solanacearum ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details