Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B)

This Recombinant Horse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B) spans the amino acid sequence from region 2-373.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase, 3-beta-HSD, Including the following 2 domains:, 3-beta-hydroxy-Delta (5) -steroid dehydrogenase, EC= 1.1.1.145, 3-beta-hyd

UniProt

O46516

Expression Region

2-373

Origin

Equus caballus (Horse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGWSCLVTGAGGFLGQRIVRLLVEEKEVQEIRALDKVFRPELREEFSKLQSKVKLTVLEG DILDEQFLKRACQGASAVIHTASIIDVTNLFNPQVTMNVNVEGTQLLLEACSQASVPIFI YTSSVAVAGPNSYREIIQNGHEEAHLETKWSSPYPYSKKLAEKAVLAANGLPLKNGGTLY TCALRPMFIYGEGSPTLYYLMHEGLNNNGILTHNCKFSRANPVYVGNIAWAHIMALRALR DPKKAPSIQGQFYYISDDTPPQSYDDLTYTLSKKWGFCLDSRMRLPIFLKYWLAFLLEIV SFLLSPIYKYRPPFDRHLVTWQNSVFTFSYKKAQRDMGYEPLFSWEEAKKRTTEWIDALV EPHQEALKTKTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-100 1x 100 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
BNC680096-500 1x 500 µL

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-100 1x 100 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-100 1x 100 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (rCLIP/1407), CF640R conjugate, 0.1mg/mL
BNC402296-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (rCLIP/1407), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granulocyte Marker (BM-1), CF488A conjugate, 0.1mg/mL
BNC880061-100 1x 100 µL

Granulocyte Marker (BM-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details