Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Peroxisomal biogenesis factor 3 (Pex3)

This Recombinant Rat Peroxisomal biogenesis factor 3 (Pex3) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Peroxisomal biogenesis factor 3, Peroxin-3, Peroxisomal assembly protein PEX3

UniProt

Q9JJK4

Expression Region

1-372

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRSMWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKLREIQEREAAEYIAQARRQYHFES NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKIISFTRSIVAVY STCMLVVLLRVQLNIIGGYIYLDNATVGKNGTSILAPPDVQQQYLSSIQHLLGDGLTELV TVIKQAVQRILGSISLKHSLSLLDLEQKLKEIRTLVEQHRSCWNDKDASKSSLCHYMMPD EETPLAAQAYGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRP TEQDLQHGNSINSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLMMEQVKDFAANV YEAFSTPQQLEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTN1 protein
80R-4307 0.1 mg

ACTN1 protein

Sign In for Pricing
View Details
HOXD1 Over-expression Lysate Product
GWB-2D58DD 0.1 mg

HOXD1 Over-expression Lysate Product

Sign In for Pricing
View Details
SDAD1 (Protein SDA1 Homolog, Nucleolar Protein 130, SDA1 Domain-Containing Protein 1, hSDA, SDAD1, NUC130) (AP)
MBS6459143-01 0.2 mL

SDAD1 (Protein SDA1 Homolog, Nucleolar Protein 130, SDA1 Domain-Containing Protein 1, hSDA, SDAD1, NUC130) (AP)

Sign In for Pricing
View Details
SDAD1 (Protein SDA1 Homolog, Nucleolar Protein 130, SDA1 Domain-Containing Protein 1, hSDA, SDAD1, NUC130) (AP)
MBS6459143-02 5x 0.2 mL

SDAD1 (Protein SDA1 Homolog, Nucleolar Protein 130, SDA1 Domain-Containing Protein 1, hSDA, SDAD1, NUC130) (AP)

Sign In for Pricing
View Details
Human Monoamine Oxidase A (MAOA) ELISA Kit
BSKH63820-01 48 Tests

Human Monoamine Oxidase A (MAOA) ELISA Kit

Sign In for Pricing
View Details
Human Monoamine Oxidase A (MAOA) ELISA Kit
BSKH63820-02 96 Tests

Human Monoamine Oxidase A (MAOA) ELISA Kit

Sign In for Pricing
View Details