Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Peroxisomal biogenesis factor 3 (Pex3)

This Recombinant Rat Peroxisomal biogenesis factor 3 (Pex3) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Peroxisomal biogenesis factor 3, Peroxin-3, Peroxisomal assembly protein PEX3

UniProt

Q9JJK4

Expression Region

1-372

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRSMWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKLREIQEREAAEYIAQARRQYHFES NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKIISFTRSIVAVY STCMLVVLLRVQLNIIGGYIYLDNATVGKNGTSILAPPDVQQQYLSSIQHLLGDGLTELV TVIKQAVQRILGSISLKHSLSLLDLEQKLKEIRTLVEQHRSCWNDKDASKSSLCHYMMPD EETPLAAQAYGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRP TEQDLQHGNSINSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLMMEQVKDFAANV YEAFSTPQQLEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WWP2 (NM_199423) Human Tagged Lenti ORF Clone
RC224229L3 10 µg

WWP2 (NM_199423) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ADAM22 (Extracellular) Antibody
abx444666 100 µg

ADAM22 (Extracellular) Antibody

Sign In for Pricing
View Details
Gm6871 3'UTR Luciferase Stable Cell Line
TU108492 1.0 mL

Gm6871 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MAP3K11 Conjugated Antibody
MBS9448171-01 0.1 mL (Biotin)

MAP3K11 Conjugated Antibody

Sign In for Pricing
View Details
MAP3K11 Conjugated Antibody
MBS9448171-02 0.1 mL (AF350)

MAP3K11 Conjugated Antibody

Sign In for Pricing
View Details
MAP3K11 Conjugated Antibody
MBS9448171-03 0.1 mL (AF405)

MAP3K11 Conjugated Antibody

Sign In for Pricing
View Details