Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxisomal biogenesis factor 3 (Pex3)

This Recombinant Mouse Peroxisomal biogenesis factor 3 (Pex3) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Peroxisomal biogenesis factor 3, Peroxin-3, Peroxisomal assembly protein PEX3

UniProt

Q9QXY9

Expression Region

1-372

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRSMWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKSRPSNKLEIWEDLKIISFTRSIVAVY STCMLVVLLRVQLNIIGGYIYLDNATVGKNGTTVLAPPDVQQQYLSSIQHLLGDGLTELV TVIKQAVQRILGSVSLKHSLSLLDLEQKLKEIRILVEQHQSSWNDKDVSRSSLCQYMMPD EETPLAAQAYGLSHRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRP TEQDLQHGNSINSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLMMEQVKDFAANV YEAFSTPQQLEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PUB39 Polyclonal Antibody
MBS9013210 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PUB39 Polyclonal Antibody

Sign In for Pricing
View Details
Vitamin B12
900172BA 1 g

Vitamin B12

Sign In for Pricing
View Details
FGF2 (NM_002006) Human Over-expression Lysate
LH19612V 100 µg

FGF2 (NM_002006) Human Over-expression Lysate

Sign In for Pricing
View Details
UBQLNL Antibody - middle region : HRP (ARP52793_P050-HRP)
ARP52793_P050-HRP 100 µL

UBQLNL Antibody - middle region : HRP (ARP52793_P050-HRP)

Sign In for Pricing
View Details
IDH3G (C-5) P
sc-365489 P 100 µg - 0.5 mL

IDH3G (C-5) P

Sign In for Pricing
View Details
Recombinant Matrix Metalloproteinase 12 (MMP12)
MBS2010158-01 0.01 mg

Recombinant Matrix Metalloproteinase 12 (MMP12)

Sign In for Pricing
View Details