Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxisomal biogenesis factor 3 (Pex3)

This Recombinant Mouse Peroxisomal biogenesis factor 3 (Pex3) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Peroxisomal biogenesis factor 3, Peroxin-3, Peroxisomal assembly protein PEX3

UniProt

Q9QXY9

Expression Region

1-372

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRSMWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKSRPSNKLEIWEDLKIISFTRSIVAVY STCMLVVLLRVQLNIIGGYIYLDNATVGKNGTTVLAPPDVQQQYLSSIQHLLGDGLTELV TVIKQAVQRILGSVSLKHSLSLLDLEQKLKEIRILVEQHQSSWNDKDVSRSSLCQYMMPD EETPLAAQAYGLSHRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRP TEQDLQHGNSINSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLMMEQVKDFAANV YEAFSTPQQLEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRP9 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-6867R-PE-Cy5.5 100 µL

NLRP9 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Biotinylated Anti-CD138 (indatuximab biosimilar) mAb
MBS1880421-01 0.05 mg

Biotinylated Anti-CD138 (indatuximab biosimilar) mAb

Sign In for Pricing
View Details
Biotinylated Anti-CD138 (indatuximab biosimilar) mAb
MBS1880421-02 0.1 mg

Biotinylated Anti-CD138 (indatuximab biosimilar) mAb

Sign In for Pricing
View Details
Biotinylated Anti-CD138 (indatuximab biosimilar) mAb
MBS1880421-03 5x 0.1 mg

Biotinylated Anti-CD138 (indatuximab biosimilar) mAb

Sign In for Pricing
View Details
Hepatocyte Specific Antigen (BSA & Azide Free)
168788-AF 100 µg

Hepatocyte Specific Antigen (BSA & Azide Free)

Sign In for Pricing
View Details
TANC2 siRNA (m)
sc-154066 10 µM

TANC2 siRNA (m)

Sign In for Pricing
View Details