Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Cell cycle control protein 50A (TMEM30A)

This Recombinant Chicken Cell cycle control protein 50A (TMEM30A) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Cell cycle control protein 50A, Transmembrane protein 30A

UniProt

Q5F362

Expression Region

1-372

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVNYSAKEEADGHPAGGGPGGGATAGGGGAVKTRKPDNTAFKQQRLPAWQPILTAGTVL PAFFIIGLIFIPIGIGIFVTSNNIREYEIDYTGVEPSSPCNKCLNVSWDSTPPCTCTINF TLEHSFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDNSSLLNPSKECEPYRTNEDKPI APCGAIANSMFNDTLELYHIENDTRTAITLIKKGIAWWTDKNVKFRNPKGDGNLTALFQG TTKPVNWPKPVYMLDSEPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSNLQPTLQAG KYSLNITYNYPVHSFDGRKRMILSTISWMGGKNPFLGIAYITVGSICFFLGVVLLIIHHK YGNRNTSADIPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IGF-I/IGF-1 Antibody (OTI4B12) [CoraFluor 1]
NBP2-71010CL1 0.1 mL

Mouse Monoclonal IGF-I/IGF-1 Antibody (OTI4B12) [CoraFluor 1]

Sign In for Pricing
View Details
Nkx6.2 Rabbit Polyclonal Antibody (Cy5.5)
orb1075309 100 µL

Nkx6.2 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Ki67 (MKI67) Mouse Monoclonal Antibody [Clone 1F11]
E45M15494V-2 50 µL

Ki67 (MKI67) Mouse Monoclonal Antibody [Clone 1F11]

Sign In for Pricing
View Details
Rabbit Polyclonal 5-Lipoxygenase Antibody [DyLight 650]
NB110-58748C 0.1 mL

Rabbit Polyclonal 5-Lipoxygenase Antibody [DyLight 650]

Sign In for Pricing
View Details
CD247 sgRNA CRISPR Lentivector (Human) (Target 3)
K0407004 1.0 µg DNA

CD247 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
CDH17 Polyclonal Antibody
MBS8532675-01 0.1 mg

CDH17 Polyclonal Antibody

Sign In for Pricing
View Details