Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 4 (Hsd3b4)

This Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 4 (Hsd3b4) spans the amino acid sequence from region 2-373.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase type 4, 3 beta-hydroxysteroid dehydrogenase type IV, 3-beta-HSD IV, 3-beta-hydroxy-5-ene steroid dehydrogenase, NADPH-dependent 3-beta-hydroxy-Delta (

UniProt

Q61767

Expression Region

2-373

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PGWSCLVTGAGGFLGQRIVRMLVQEEELQEIRALFRTFGRKQEEELSKLQTKTKVTVLKG DILDAQCLKRACQGMSAVIHTAAAIDPLGAASRQTILDVNLKGTQLLLDACVEANVPTFI YSSSVLVAGPNSYKEIILNAHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLH TCALRLSFIYGEECQVTSTTVKTALKNNSIIKKNATFSIANPVYVGNAAWAHILAARSLQ DPKKSPSIQGQFYYITDDTPHQSYDDLKCTLSKEWGLRLDTSWSLPLPLLYWLAFLLETV SFLLRPVYNYRPPFNRLLITVLNSVFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV MQHREIGNKKSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF-alpha Antibody Cocktail
orb749825-01 20 µg

TNF-alpha Antibody Cocktail

Sign In for Pricing
View Details
TNF-alpha Antibody Cocktail
orb749825-02 100 µg

TNF-alpha Antibody Cocktail

Sign In for Pricing
View Details
Rabbit Monoclonal N-Cadherin Antibody (CDH2/8862R) [PerCP]
NBP3-24009PCP 0.1 mL

Rabbit Monoclonal N-Cadherin Antibody (CDH2/8862R) [PerCP]

Sign In for Pricing
View Details
Mouse Kisspeptin 1 (KISS1) ELISA Kit
BSKM64872-01 48 Tests

Mouse Kisspeptin 1 (KISS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Kisspeptin 1 (KISS1) ELISA Kit
BSKM64872-02 96 Tests

Mouse Kisspeptin 1 (KISS1) ELISA Kit

Sign In for Pricing
View Details
Efna1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7020404 1.0 µg DNA

Efna1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details