Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 4 (Hsd3b4)

This Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 4 (Hsd3b4) spans the amino acid sequence from region 2-373.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase type 4, 3 beta-hydroxysteroid dehydrogenase type IV, 3-beta-HSD IV, 3-beta-hydroxy-5-ene steroid dehydrogenase, NADPH-dependent 3-beta-hydroxy-Delta (

UniProt

Q61767

Expression Region

2-373

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PGWSCLVTGAGGFLGQRIVRMLVQEEELQEIRALFRTFGRKQEEELSKLQTKTKVTVLKG DILDAQCLKRACQGMSAVIHTAAAIDPLGAASRQTILDVNLKGTQLLLDACVEANVPTFI YSSSVLVAGPNSYKEIILNAHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLH TCALRLSFIYGEECQVTSTTVKTALKNNSIIKKNATFSIANPVYVGNAAWAHILAARSLQ DPKKSPSIQGQFYYITDDTPHQSYDDLKCTLSKEWGLRLDTSWSLPLPLLYWLAFLLETV SFLLRPVYNYRPPFNRLLITVLNSVFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV MQHREIGNKKSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit
MBS2510201-01 24 Tests

Monkey AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit

Sign In for Pricing
View Details
Monkey AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit
MBS2510201-02 48 Tests

Monkey AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit

Sign In for Pricing
View Details
Monkey AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit
MBS2510201-03 96 Tests

Monkey AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit

Sign In for Pricing
View Details
Monkey AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit
MBS2510201-04 5x 96 Tests

Monkey AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit

Sign In for Pricing
View Details
Monkey AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit
MBS2510201-05 10x 96 Tests

Monkey AVPR1A (Arginine Vasopressin Receptor 1A) ELISA Kit

Sign In for Pricing
View Details
PTEN peptide
orb319205-01 1 mg

PTEN peptide

Sign In for Pricing
View Details