Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesocricetus auratus 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 (HSD3B1)

This Recombinant Mesocricetus auratus 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 (HSD3B1) spans the amino acid sequence from region 2-373.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I, 3-beta-HSD I, Including the following 2 domains:, 3-b

UniProt

Q60555

Expression Region

2-373

Origin

Mesocricetus auratus (Golden hamster)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PGWSCLVTGAGGFLGQRIIRMLVQEKELQEVRALDKVFRPETREEFCKLQTKTKVTVLEG DILDAQCLRRACQGISVVIHTAAAIDVFGAIPRQTIIDINLKGTLNLLEACVQASVPAFI YTSSIDVAGPNSYKEIVLNGHEEQQHESTWSDPYPYSKKMAEKAVLAANGSSLKNGGTLH TCALRPMYIYGEKSPLISVTIIRAVKNSGILDVTGKFSTVNPVYVNNAAWAHILAARGLQ DPRKSPNIQGQFYYISDDTPHQSYDDLNYVLSKDWGLRPDSSWRPPVALLYWLGFLLELV SFLLRPVYNYQPPFNRHLVTLSNTVFTFSYKKAQRDLGYEPLVGWEEARENTSEWIGSLV EQHKGTLNTKAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD22 / BL-CAM (B-Cell Marker) (RFB4), CF488A conjugate, 0.1mg/mL
BNC881594-100 1x 100 µL

CD22 / BL-CAM (B-Cell Marker) (RFB4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2819R), CF740 conjugate, 0.1mg/mL
BNC742819-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2819R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details