Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesocricetus auratus 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (HSD3B2)

This Recombinant Mesocricetus auratus 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (HSD3B2) spans the amino acid sequence from region 2-373.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II, 3-beta-HSD II, Including the following 2 domains:, 3

UniProt

Q64421

Expression Region

2-373

Origin

Mesocricetus auratus (Golden hamster)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PGWSCLVTGAGGFLGQRIIHLLVQEKDLEEVRLLDKVFRPETREEFFKLQTKTKVTVLEG DILDAQCLRRACQGISVVIHTAAAIDVWGIIPRQTIIDINVKGTLNLLEACVQASVPAFI YTSSIDVAGPNSYKEIVLNGHEEQQHESTWSDPYPYSKMMAEKAVLAANGSFLKNGGTLH TCALRPMYIYGEKSSILSGIMIRAIKNNGILKVTGKFSTVNPVYVSNAAWAHILAARGLQ DPKKSPNIQGQFYYISDDTPHQSYDDLNNTLSKKWGLRPDSSWRPPVALLYWLGFLLELV NFLLRPVYNYQPPFTRYLVTISNTVFTFSYKKAQRDLGYEPLVGWEEARENTSEWIGSLV EQHKGTLNTKAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mab21l2 (NM_001109391) Rat Tagged Lenti ORF Clone
RR206862L3 10 µg

Mab21l2 (NM_001109391) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Thrombospondin 1 (THBS1, THBS, THBS-1, TSP, TSP-1, TSP1) (MaxLight 650)
MBS6440617-01 0.1 mL

Thrombospondin 1 (THBS1, THBS, THBS-1, TSP, TSP-1, TSP1) (MaxLight 650)

Sign In for Pricing
View Details
Thrombospondin 1 (THBS1, THBS, THBS-1, TSP, TSP-1, TSP1) (MaxLight 650)
MBS6440617-02 5x 0.1 mL

Thrombospondin 1 (THBS1, THBS, THBS-1, TSP, TSP-1, TSP1) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit polyclonal S100 Protein antibody (Prediluted for IHC)
MBS5307932-01 7 mL

Rabbit polyclonal S100 Protein antibody (Prediluted for IHC)

Sign In for Pricing
View Details
Rabbit polyclonal S100 Protein antibody (Prediluted for IHC)
MBS5307932-02 5x 7 mL

Rabbit polyclonal S100 Protein antibody (Prediluted for IHC)

Sign In for Pricing
View Details
Bovine High Mobility Group Protein 20A (HMG20A) ELISA Kit
MBS9388397-01 48 Well

Bovine High Mobility Group Protein 20A (HMG20A) ELISA Kit

Sign In for Pricing
View Details