Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B)

This Recombinant Pig 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B) spans the amino acid sequence from region 2-373.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase, 3-beta-HSD, Including the following 2 domains:, 3-beta-hydroxy-Delta (5) -steroid dehydrogenase, EC= 1.1.1.145, 3-beta-hyd

UniProt

Q9N119

Expression Region

2-373

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGWSCLVTGGGGFLGQRIVHLLLEEKDLQEIRVLDKVFKPEVREEFSKLQSKIKLTMLEG DILDEQCLKGACQGASVVIHTASIIDVVNAVGRETVMKVNVKGTQLLLEACVQASVPVFI HTSSIEVAGPNSYREVIQNACEEDRLETAWSAPYPLSKKLAEKAVLEANGWALQNGGTLH TCALRPMYIYGEGSPFIFAHMNKALENNGVLTHNSKFSRVNPVYVGNVAWAHILALRALR DPRKALSVQGQFYYVADDTPPQSYDDLNYTLGKEWGFCLDSRRSLPPSLRYWLAFLLEIV SFLLSPIYNYQPPFNRHFVTLCNSVFTVSYKKAQRDLGYEPLFTWEEAKQKTKAWVGSLV KQHKEALKTKTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-500 1x 500 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-100 1x 100 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-100 1x 100 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details