Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2)

This Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2) spans the amino acid sequence from region 2-373.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II, 3-beta-HSD II, Including the following 2 domains:, 3

UniProt

P26149

Expression Region

2-373

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PGWSCLVTGAGGFLGQRIIQLLVQEEDLEEIRVLDKVFRPETRKEFFNLETSIKVTVLEG DILDTQYLRRACQGISVVIHTAAIIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFI FSSSVDVAGPNSYKEIVLNGHEEECHESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQ TCALRPMCIYGERSPLISNIIIMALKHKGILRSFGKFNTANPVYVGNVAWAHILAARGLR DPKKSPNIQGEFYYISDDTPHQSFDDISYTLSKEWGFCLDSSWSLPVPLLYWLAFLLETV SFLLSPIYRYIPPFNRHLVTLSGSTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV EQHRETLDTKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLT-1
C07361-5mg 5 mg

BLT-1

Sign In for Pricing
View Details
RPS16P7 3'UTR GFP Stable Cell Line
TU072035 1.0 mL

RPS16P7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) 5mg
A23002-5 5 mg

Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) 5mg

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 10B (WNT10B) ELISA Kit
YLA1819RA-01 48 Tests

Rat Wingless Type MMTV Integration Site Family, Member 10B (WNT10B) ELISA Kit

Sign In for Pricing
View Details
Rat Wingless Type MMTV Integration Site Family, Member 10B (WNT10B) ELISA Kit
YLA1819RA-02 96 Tests

Rat Wingless Type MMTV Integration Site Family, Member 10B (WNT10B) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse CTSE
Pr22743-01 10 µg

Recombinant Mouse CTSE

Sign In for Pricing
View Details