Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B)

This Recombinant Bovine 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B) spans the amino acid sequence from region 2-373.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase, 3-beta-HSD, Including the following 2 domains:, 3-beta-hydroxy-Delta (5) -steroid dehydrogenase, EC= 1.1.1.145, 3-beta-hyd

UniProt

P14893

Expression Region

2-373

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGWSCLVTGGGGFLGQRIICLLVEEKDLQEIRVLDKVFRPEVREEFSKLQSKIKLTLLEG DILDEQCLKGACQGTSVVIHTASVIDVRNAVPRETIMNVNVKGTQLLLEACVQASVPVFI HTSTIEVAGPNSYREIIQDGREEEHHESAWSSPYPYSKKLAEKAVLGANGWALKNGGTLY TCALRPMYIYGEGSPFLSAYMHGALNNNGILTNHCKFSRVNPVYVGNVAWAHILALRALR DPKKVPNIQGQFYYISDDTPHQSYDDLNYTLSKEWGFCLDSRMSLPISLQYWLAFLLEIV SFLLSPIYKYNPCFNRHLVTLSNSVFTFSYKKAQRDLGYEPLYTWEEAKQKTKEWIGSLV KQHKETLKTKIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-100 1x 100 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-100 1x 100 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF488A conjugate, 0.1mg/mL
BNC882427-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF488A conjugate, 0.1mg/mL
BNC881481-100 1x 100 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF405S conjugate, 0.1mg/mL
BNC042227-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details