Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 3 (Hsd3b3)

This Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 3 (Hsd3b3) spans the amino acid sequence from region 2-373.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 3, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type III, 3-beta-HSD III, Including the following 2 domains:

UniProt

P26150

Expression Region

2-373

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PGWSCLVTGAGGFLGQRIIQLLVQEKDLEEIRVLDKVFKPETREQFFNLGTSIKVTVLEG DILDTQYLRRACQGISVVIHTAAIIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFI FSSSVDVAGPNSYKDIVLNGHEDEHRESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQ TCALRPMCIYGERSQFLSNTIIKALKNKFILRGGGKFSTANPVYVGNVAWAHILAARGLR NPKKSPNIQGEFYYISDDTPHQSYDDLNYTLSKEWGFCLNSRWYLPVPILYWLAFLLETV SFLLSPIYRYIPPFNRHLVTLTASTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV EQHRETLDTKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBV Polyclonal Purified Antibody, Colloidal Gold Labeled, 1mL 15nm
GM-603-15 1 mL

HBV Polyclonal Purified Antibody, Colloidal Gold Labeled, 1mL 15nm

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (CALNA/2353), CF488A conjugate, 0.1mg/mL
BNC882353-500 1x 500 µL

Calcineurin A / PPP3CA (CALNA/2353), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), CF640R conjugate, 0.1mg/mL
BNC403261-500 1x 500 µL

Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arf6 (NM_007481) Mouse Tagged ORF Clone
MG201520 10 µg

Arf6 (NM_007481) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Oleandomycin
TRC-O517500-10MG 10 mg

Oleandomycin

Sign In for Pricing
View Details
THNSL2 (NM_018271) Human Recombinant Protein
TP309049L 1 mg

THNSL2 (NM_018271) Human Recombinant Protein

Sign In for Pricing
View Details