Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat 3 beta-hydroxysteroid dehydrogenase type 5 (Hsd3b5)

This Recombinant Rat 3 beta-hydroxysteroid dehydrogenase type 5 (Hsd3b5) spans the amino acid sequence from region 2-373.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase type 5, 3 beta-hydroxysteroid dehydrogenase type V, 3-beta-HSD V, 3-beta-hydroxy-5-ene steroid dehydrogenase, NADPH-dependent 3-beta-hydroxy-Delta (5)

UniProt

P27364

Expression Region

2-373

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PGWSCLVTGAGGFLGQRIVQMLVQEKELQEVRVLYRTFSPKHKEELSKLQTKAKVTVLRG DIVDAQFLRRACQGMSVIIHTAAALDIAGFLPRQTILDVNVKGTQLLLDACVEASVPAFI YSSSTGVAGPNSYKETILNDREEEHRESTWSNPYPYSKRMAEKAVLAANGSILKNGGTFH TCALRLPFIYGEESQIISTMVNRALKNNSIIKRHATFSIANPVYVGNAAWAHILAARGLR DPEKSQSIQGQFYYISDDTPHQSYDDLNYTLSKEWGFCLDSSWSLPLPLLYWLAFLLETV SFLLRPFYNYRPPFNRFMVTILNSVFTISYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV EQHRETLDTKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLJ20097 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2503073 100 µL

FLJ20097 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
ATP1B4 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
12682156 3x 1.0 µg DNA

ATP1B4 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
RP9P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV706346 1.0 µg DNA

RP9P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01400 (AtMg01400)
MBS1054810-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01400 (AtMg01400)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01400 (AtMg01400)
MBS1054810-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01400 (AtMg01400)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01400 (AtMg01400)
MBS1054810-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01400 (AtMg01400)

Sign In for Pricing
View Details