Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphoglycerate transport regulatory protein pgtC (pgtC)

This Recombinant Phosphoglycerate transport regulatory protein pgtC (pgtC) spans the amino acid sequence from region 25-397.

Product Specifications

Product Name Alternative

Phosphoglycerate transport regulatory protein pgtC

UniProt

P0A234

Expression Region

25-397

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WIIQRWQTEPGSVMIRTLNRTSGSLEQLLDTANAENVDLILTSSPMLLQHLQEHQKLALL DSAPAASQKLVPRSIRSTSVAVAVSGFGLLINRSALAARHLPPPADWQDMGLPSYQGALL MSSPSRSDTNHLMVESLLQQKGWTAGWATLLAISGNLVTISSRSFGVADKIKSGLGVAGP VIDNYANLLLNDPNLAFTYFPYSAVSPTYVAVLKNSRHADEARAFIHYLLSPKGQRILAD ANTGKYPVAPLSADNPRAAQQQRLMAQPPLNYRLILKRQQLVQRMFDTAISFRLAQLKDA WRALHSAETRLKRPLPEIRALLTSVPVDAASSEDETWLAQFDNKSFAEQKMMEWQIWFLN NQRLAIHKLEELK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF405S conjugate, 0.1mg/mL
BNC041317-100 1x 100 µL

Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hsp20 Recombinant Rabbit Monoclonal Antibody [SD086-03]
ET1612-81 100 µL

Hsp20 Recombinant Rabbit Monoclonal Antibody [SD086-03]

Sign In for Pricing
View Details
VILIP1 Recombinant Rabbit monoclonal Antibody
HA750577 100 µL

VILIP1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
(+)-Quisqualic Acid
TRC-Q825000-5MG 5 mg

(+)-Quisqualic Acid

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB504636 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
N-Succinimidyl 4-Azidosalicylate
TRC-S690130-50MG 50 mg

N-Succinimidyl 4-Azidosalicylate

Sign In for Pricing
View Details