Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Peroxisomal biogenesis factor 3 (PEX3)

This Recombinant Macaca fascicularis Peroxisomal biogenesis factor 3 (PEX3) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

Peroxisomal biogenesis factor 3, Peroxin-3, Peroxisomal assembly protein PEX3

UniProt

Q60HE1

Expression Region

1-373

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKIISFTRSIVAVY STCMLVVLLRVQLNIIGGYIYLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELI TVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKSLLCHYMMP DEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFR PTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAAN VYEAFSTPQQLEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-9 Antibody (623153) [Alexa Fluor 532]
FAB209X 0.1 mL

Mouse Monoclonal IL-9 Antibody (623153) [Alexa Fluor 532]

Sign In for Pricing
View Details
LIN52 Antibody - N-terminal region
OAAB09776-400UL 400 µL

LIN52 Antibody - N-terminal region

Sign In for Pricing
View Details
(Tetrahydro-2H-pyran-4-yl) methyl tosylate
sc-264395A 5 g

(Tetrahydro-2H-pyran-4-yl) methyl tosylate

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), 0.2mg/mL
BNUB3795-500 1x 500 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), 0.2mg/mL

Sign In for Pricing
View Details
RT1-EC2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV671378 1.0 µg DNA

RT1-EC2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
BHLHA15 ORF Vector (Human) (pORF)
ORF016156 1.0 µg DNA

BHLHA15 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details