Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Peroxisomal biogenesis factor 3 (PEX3)

This Recombinant Macaca fascicularis Peroxisomal biogenesis factor 3 (PEX3) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

Peroxisomal biogenesis factor 3, Peroxin-3, Peroxisomal assembly protein PEX3

UniProt

Q60HE1

Expression Region

1-373

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKIISFTRSIVAVY STCMLVVLLRVQLNIIGGYIYLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELI TVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKSLLCHYMMP DEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFR PTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAAN VYEAFSTPQQLEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCDH Protein Lysate (Mouse) with C-HA Tag
21375035 100 µg

GCDH Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Telomerase Binding Protein, P23 Antibody, AbBy Fluor™ 680 Conjugated
bs-1909R-BF680 100 µL

Telomerase Binding Protein, P23 Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Tenascin C (Tenascin-C, TNC, TN-C, TN, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP-150-225, Hexabrachion, HXB, JI, Myotendinous Antigen, Neuronectin) (MaxLight 490)
MBS6254289-01 0.1 mL

Tenascin C (Tenascin-C, TNC, TN-C, TN, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP-150-225, Hexabrachion, HXB, JI, Myotendinous Antigen, Neuronectin) (MaxLight 490)

Sign In for Pricing
View Details
Tenascin C (Tenascin-C, TNC, TN-C, TN, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP-150-225, Hexabrachion, HXB, JI, Myotendinous Antigen, Neuronectin) (MaxLight 490)
MBS6254289-02 5x 0.1 mL

Tenascin C (Tenascin-C, TNC, TN-C, TN, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP-150-225, Hexabrachion, HXB, JI, Myotendinous Antigen, Neuronectin) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Polyclonal SLC31A1/CTR1 Antibody [mFluor Violet 610 SE]
NB100-402MFV610 0.1 mL

Rabbit Polyclonal SLC31A1/CTR1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
UBE4A Protein Vector (Rat) (pPM-C-HA)
49021026 500 ng

UBE4A Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details