Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus longicaudatus Peroxisomal biogenesis factor 3 (PEX3)

This Recombinant Cricetulus longicaudatus Peroxisomal biogenesis factor 3 (PEX3) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

Peroxisomal biogenesis factor 3, Peroxin-3, Peroxisomal assembly protein PEX3

UniProt

Q9JJK3

Expression Region

1-373

Origin

Cricetulus longicaudatus (Long-tailed dwarf hamster) (Chinese hamster)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRSMWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKIISFTRSIVAVY STCMLVVLLRVQLNIIGGYIYLDNATVGKNGTTVLAPPDVQQQYLSSIQHLLGDGLTELV TVIKQAVQRILGSVSLKHSLSLLDLEQKLKEIRILVEQHRSPSWIDKDVSKSSLCQYMMP DEETPLAAQAYGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFR PTEQDLQHGNSINSLSSVSLPLAKIIPIVNGQIHSVCSDTPSHFVQDLLMMEQVKDFAAN VYEAFSTPQQLEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), 1mg/mL
BNUM0218-50 1x 50 µL

CD100 (Semaphorin-4D) (A8), 1mg/mL

Sign In for Pricing
View Details
WDR23 (DCAF11) (NM_001163484) Human Over-expression Lysate
LC431978 20 µg

WDR23 (DCAF11) (NM_001163484) Human Over-expression Lysate

Sign In for Pricing
View Details
CPVL Human Gene Knockout Kit (CRISPR)
KN402336 1 Kit

CPVL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MMP-9 Recombinant Rabbit monoclonal Antibody
HA751070 100 µL

MMP-9 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS501496 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Steviol glycosides
TRC-S686730-10MG 10 mg

Steviol glycosides

Sign In for Pricing
View Details