Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus HKU1 Hemagglutinin-esterase (HE)

This Recombinant Human coronavirus HKU1 Hemagglutinin-esterase (HE) spans the amino acid sequence from region 14-386.

Product Specifications

Product Name Alternative

Hemagglutinin-esterase, HE protein, EC= 3.1.1.53, E3 glycoprotein

UniProt

Q5MQD1

Expression Region

14-386

Origin

Human coronavirus HKU1 (isolate N1) (HCoV-HKU1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FNEPLNVVSHLNHDWFLFGDSRSDCNHINNLKIKNFDYLDIHPSLCNNGKISSSAGDSIF KSFHFTRFYNYTGEGDQIIFYEGVNFNPYHRFKCFPNGSNDVWLLNKVRFYRALYSNMAF FRYLTFVDIPYNVSLSKFNSCKSDILSLNNPIFINYSKEVYFTLLGCSLYLVPLCLFKSN FSQYYYNIDTGSVYGFSNVVYPDLDCIYISLKPGSYKVSTTAPFLSLPTKALCFDKSKQF VPVQVVDSRWNNERASDISLSVACQLPYCYFRNSSANYVGKYDINHGDSGFISILSGLLY NVSCISYYGVFLYDNFTSIWPYYSFGRCPTSSIIKHPICVYDFLPIILQGILLCLALLFV VFLLFLLYNDKSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF740 conjugate, 0.1mg/mL
BNC740345-500 1x 500 µL

CD4 (EDU-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-500 1x 500 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF405S conjugate, 0.1mg/mL
BNC042350-500 1x 500 µL

GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 3 (MUC3/1154), CF640R conjugate, 0.1mg/mL
BNC401154-500 1x 500 µL

Mucin 3 (MUC3/1154), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF405S conjugate, 0.1mg/mL
BNC042051-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details