Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0007 (MJ0007)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0007 (MJ0007) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0007

UniProt

Q60318

Expression Region

1-373

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMKLKAIEKLMQKFASRKEQLYKQKEEGRKVFGMFCAYVPIEIILAANAIPVGLCGGKND TIPIAEEDLPRNLCPLIKSSYGFKKAKTCPYFEASDIVIGETTCEGKKKMFELMERLVPM HIMHLPHMKDEDSLKIWIKEVEKLKELVEKETGNKITEEKLKETVDKVNKVRELFYKLYE LRKNKPAPIKGLDVLKLFQFAYLLDIDDTIGILEDLIEELEERVKKGEGYEGKRILITGC PMVAGNNKIVEIIEEVGGVVVGEESCTGTRFFENFVEGYSVEDIAKRYFKIPCACRFKND ERVENIKRLVKELDVDGVVYYTLQYCHTFNIEGAKVEEALKEEGIPIIRIETDYSESDRE QLKTRLEAFIEMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptpn2 Mouse Gene Knockout Kit (CRISPR)
KN514212 1 Kit

Ptpn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H6]
TA506100AM 100 µL

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H6]

Sign In for Pricing
View Details
Drc7 Mouse Gene Knockout Kit (CRISPR)
KN502656 1 Kit

Drc7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Bckdha activation kit by CRISPRa
GA200378 1 Kit

Mouse Bckdha activation kit by CRISPRa

Sign In for Pricing
View Details
Human ATL3, C-His Tag
HA210690-01 20 µg

Human ATL3, C-His Tag

Sign In for Pricing
View Details
Human ATL3, C-His Tag
HA210690-02 50 µg

Human ATL3, C-His Tag

Sign In for Pricing
View Details