Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0007 (MJ0007)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0007 (MJ0007) spans the amino acid sequence from region 1-373.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0007

UniProt

Q60318

Expression Region

1-373

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMKLKAIEKLMQKFASRKEQLYKQKEEGRKVFGMFCAYVPIEIILAANAIPVGLCGGKND TIPIAEEDLPRNLCPLIKSSYGFKKAKTCPYFEASDIVIGETTCEGKKKMFELMERLVPM HIMHLPHMKDEDSLKIWIKEVEKLKELVEKETGNKITEEKLKETVDKVNKVRELFYKLYE LRKNKPAPIKGLDVLKLFQFAYLLDIDDTIGILEDLIEELEERVKKGEGYEGKRILITGC PMVAGNNKIVEIIEEVGGVVVGEESCTGTRFFENFVEGYSVEDIAKRYFKIPCACRFKND ERVENIKRLVKELDVDGVVYYTLQYCHTFNIEGAKVEEALKEEGIPIIRIETDYSESDRE QLKTRLEAFIEMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Butoxy-4-nitrobenzoic Acid
TRC-B922610-25MG 25 mg

3-Butoxy-4-nitrobenzoic Acid

Sign In for Pricing
View Details
Arachidonic Acid N-Hydroxysuccinimidyl Ester
TRC-A765010-5MG 5 mg

Arachidonic Acid N-Hydroxysuccinimidyl Ester

Sign In for Pricing
View Details
Human OR52D1 activation kit by CRISPRa
GA118103 1 Kit

Human OR52D1 activation kit by CRISPRa

Sign In for Pricing
View Details
Vitamin D Binding protein (GC) Mouse Monoclonal Antibody [Clone ID: OTI2A1]
CF809264 100 µg

Vitamin D Binding protein (GC) Mouse Monoclonal Antibody [Clone ID: OTI2A1]

Sign In for Pricing
View Details
INSC (C-term) Rabbit Polyclonal Antibody
AP52217PU-N 400 µL

INSC (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HPR (Center) Rabbit Polyclonal Antibody
AP52093PU-N 400 µL

HPR (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details