Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe UPF0674 endoplasmic reticulum membrane protein C2G5.01 (SPBC2G5.01)

This Recombinant Schizosaccharomyces pombe UPF0674 endoplasmic reticulum membrane protein C2G5.01 (SPBC2G5.01) spans the amino acid sequence from region 1-374.

Product Specifications

Product Name Alternative

UPF0674 endoplasmic reticulum membrane protein C2G5.01

UniProt

O94280

Expression Region

1-374

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINKKLLFLVFALAKGVLADEEDEYEEDYNMNPELENPGMFKHVDWRDFRLEFVILACFF LYVFSFITQKKKNQKIASRWYGSLQSSFRQQFAQYGPGPNSSPIIYDSPTEFSSYLTGRL NVKNVYTTLQLFPRQDLLAYSLNQIVEILLGNVMSSVLPVADRFQFDLTLADQNLKAERF VFAIVHKDCMRILREIRYDLSFTRISSSPYLPETHVLMSENNECSQAIFEIPEFMSSINE CIENLEYFIVTDQPSVPPATEKDYVTKPRIEASIRIKKITSLSGLSNATGSALFNSLLLV ADSCPKFQWRPEVSKKLTSARKLAFEQVVHASAAKAAKKKVKSSGDISKLSESDQKKRME RERQRKMRRRAKKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-100 1x 100 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-500 1x 500 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF488A conjugate, 0.1mg/mL
BNC881687-100 1x 100 µL

VEGF (Vascular Endothelial Growth Factor) (VG76e), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details