Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Peroxisome biogenesis factor 10 (pex10)

This Recombinant Dictyostelium discoideum Peroxisome biogenesis factor 10 (pex10) spans the amino acid sequence from region 1-374.

Product Specifications

Product Name Alternative

Peroxisome biogenesis factor 10, Peroxin-10, Peroxisomal biogenesis factor 10, Peroxisome assembly protein 10

UniProt

Q54S31

Expression Region

1-374

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNVQSQSNSHHPVHNIVNRSPTSRSEQQIRSIPPTNNNNNNNNNSINNINNNTQRQPLN NNNNNNNNINRNNSNLYPSYADQPDILRSSQKDEYYKKLFEDQCFEMLTRITGPRFIMNR QSESKLLANTIYYLLTTMIGSQTLGEEYCNLRKIKDKTFSIPSIPDRIKLYFFHLLAPYL IKKSLPKLFQRHPKLYILKEIFPKFERLHLALFYFNGSYFEFSKRLSDIRYIFNRKIDQK RPKYDILGLLIIIQILLSTFMYLKENSFFLKQQQKDGGCNGDGEEDNQDLNKDIKIEQVD SVINNNNQDQNNNQEEEEEQKCTLCLEVRTHTTATICGHLFCWHCITEWCNNKEQCPVCR CPISIRTCVPLYNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL
BNC940676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
BNC472216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details