Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0754 membrane protein SAS1767 (SAS1767)

This Recombinant Staphylococcus aureus UPF0754 membrane protein SAS1767 (SAS1767) spans the amino acid sequence from region 1-374.

Product Specifications

Product Name Alternative

UPF0754 membrane protein SAS1767

UniProt

Q6G889

Expression Region

1-374

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNALFIIIFMIVVGAIIGGITNVIAIRMLFHPFKPYYIFKFRVPFTPGLIPKRREEIATK IGQVIEEHLLTETLINEKLKSEQSQQAIESMIQQQLQKLTKDQLSIKQITSQIDIDLEQV LQTNGNQYIESQLNNYYTKHQNQTIASLLPNQLVTFLDQHVDNATDLLCDRARNYLSSAK GTQDINDMLDTFFNEKGKLFGMLQMFMTKESIADRIQQELIRLTSHPKARTIVTSLITNE YQTFKDKPLNELLDASQFNEIAENLSVYVTTYASKQANKPVVTLMPQFVDYLEGQLSSKL ANLIIEKLSIHLSTIMKKVDLRGLIEEQINTFDLDYIEKLIIEIANKELKLIMSLGFILG GIIGFFQGLVAIFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-100 1x 100 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-100 1x 100 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/837), CF568 conjugate, 0.1mg/mL
BNC680837-500 1x 500 µL

Ep-CAM / CD326 (EGP40/837), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF647 conjugate, 0.1mg/mL
BNC472659-100 1x 100 µL

Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGFalpha (P/T1), CF488A conjugate, 0.1mg/mL
BNC880787-100 1x 100 µL

TGFalpha (P/T1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details