Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Orgyia pseudotsugata multicapsid polyhedrosis virus Occlusion-derived virus envelope protein E56 (ODVP6E)

This Recombinant Orgyia pseudotsugata multicapsid polyhedrosis virus Occlusion-derived virus envelope protein E56 (ODVP6E) spans the amino acid sequence from region 1-374.

Product Specifications

Product Name Alternative

Occlusion-derived virus envelope protein E56, ODV-E56, ODVP-6E

UniProt

Q83953

Expression Region

1-374

Origin

Orgyia pseudotsugata multicapsid polyhedrosis virus (OpMNPV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFFTNLRRVNKVYPDSASFIVDNRLLLNTTPAGFTNVLNVPSTRNLGNGRFEPGYNLSN NQFVSAGDINRITRSNDVPRIRGVFQGISDPQIGSLNQLRRVDNVPDANLHVKRTRGDAV KQSFPETNVRSAEGVDRALQQNPRLNTYLQGAKAAGVGVLLAGGAYLTFSAATLVQDIIR ALNNTGGSYYVRGSDGGETADACLLLHRTCQRDPNMNTSEVAICANDPLVSNTAQLQAIC SGFNYEQEQTVCRQSDPAADPDSPQFVDVSDLLPGQTIMCIEPYSLGDLIGDLGLDHLLG EEGLVGKSSNSSDSVSNKLMPLIWLIGAVLFLALVVYLIYRFLIKGGGSSTTNAPPVVIV PPPATTNLNPQQQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PENK Antibody
C31037-01 50 μL

PENK Antibody

Sign In for Pricing
View Details
PENK Antibody
C31037-02 100 µL

PENK Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Cathepsin G Antibody [Alexa Fluor 647]
NBP2-97363AF647 0.1 mL

Rabbit Polyclonal Cathepsin G Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
AMPK gamma 3 Polyclonal Antibody, Cy5.5 Conjugated
bs-3968R-Cy5.5 100 µL

AMPK gamma 3 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
1-Hexadecyl-3-methylimidazolium tricyanomethanide
IL-0337-HP-BULK 1 Each

1-Hexadecyl-3-methylimidazolium tricyanomethanide

Sign In for Pricing
View Details
CACNB1 (NM_000723) Human Tagged ORF Clone
RC207230 10 µg

CACNB1 (NM_000723) Human Tagged ORF Clone

Sign In for Pricing
View Details