Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable dipeptidase pepE (pepE)

This Recombinant Probable dipeptidase pepE (pepE) spans the amino acid sequence from region 1-375.

Product Specifications

Product Name Alternative

Probable dipeptidase pepE, EC= 3.4.13.-

UniProt

P65811

Expression Region

1-375

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSRRFDAEVYARRLALAAAATADAGLAGLVITPGYDLCYLIGSRAETFERLTALVLPAA GAPAVVLPRLELAALKQSAAAELGLRVCDWVDGDDPYGLVSAVLGGAPVATAVTDSMPAL HMLPLADALGVLPVLATDVLRRLRMVKEETEIDALRKAGAAIDRVHARVPEFLVPGRTEA DVAADIAEAIVAEGHSEVAFVIVGSGPHGADPHHGYSDRELREGDIVVVDIGGTYGPGYH SDSTRTYSIGEPDSDVAQSYSMLQRAQRAAFEAIRPGVTAEQVDAAARDVLAEAGLAEYF VHRTGHGIGLCVHEEPYIVAGNDLVLVPGMAFSIEPGIYFPGRWGARIEDIVIVTEDGAV SVNNCPHELIVVPVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC63 (Translocation Protein SEC63 Homolog, SEC63L, DNAJC23, ERdj2, PRO2507) (MaxLight 550)
MBS6402271-01 0.1 mL

SEC63 (Translocation Protein SEC63 Homolog, SEC63L, DNAJC23, ERdj2, PRO2507) (MaxLight 550)

Sign In for Pricing
View Details
SEC63 (Translocation Protein SEC63 Homolog, SEC63L, DNAJC23, ERdj2, PRO2507) (MaxLight 550)
MBS6402271-02 5x 0.1 mL

SEC63 (Translocation Protein SEC63 Homolog, SEC63L, DNAJC23, ERdj2, PRO2507) (MaxLight 550)

Sign In for Pricing
View Details
Phospho-Mre11 (Ser678) Rabbit Polyclonal Antibody (BF750)
orb2486727 100 µL

Phospho-Mre11 (Ser678) Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Kv3.2 (KCNC2) (NM_153748) Human Tagged ORF Clone
RC210777 10 µg

Kv3.2 (KCNC2) (NM_153748) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Cdh26 activation kit by CRISPRa
GA217117 1 Kit

Mouse Cdh26 activation kit by CRISPRa

Sign In for Pricing
View Details
GIT2 Rabbit Polyclonal Antibody (Carrier-free)
orb3105697 100 µg

GIT2 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details